General Information

  • ID:  hor003242
  • Uniprot ID:  A0A8C2TPG4
  • Protein name:  Neuropeptide 2
  • Gene name:  PNOC
  • Organism:  Coturnix japonica (Japanese quail) (Coturnix coturnix japonica)
  • Family:  Opioid neuropeptide precursor family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Coturnix (genus), Perdicinae (subfamily), Phasianidae (family), Galliformes (order), Galloanserae (superorder), Neognathae (infraclass), Aves (class), Coelurosauria, Theropoda, Saurischia, Dinosauria, Archosauria, Archelosauria, Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007268 chemical synaptic transmission
  • GO CC:  GO:0005576 extracellular region; GO:0045202 synapse

Sequence Information

  • Sequence:  SEFLKQYLGMSPR
  • Length:  13(164-176)
  • Propeptide:  MRAVLWDLLLLCLFARARSDCRGDCLRCDRHFYHDGFDLLVCILECEGEAVPRATWEMCATSIRSAPRPGATGVLGAMEPAEAVASPLQVSELLRRRDAEDGGAGMAPGAFPSQDEDISRRLGGGFPRETRGSWPAARGVQKRYGGFIGVRKSARKWNNQKRFSEFLKQYLGMSPRSTFRHRIPAPSARHRQN
  • Signal peptide:  MRAVLWDLLLLCLFARARS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor003242_AF2.pdbhor003242_ESM.pdb

Physical Information

Mass: 177002 Formula: C70H110N18O20S
Absent amino acids: ACDHINTVW Common amino acids: LS
pI: 9.3 Basic residues: 2
Polar residues: 4 Hydrophobic residues: 3
Hydrophobicity: -61.54 Boman Index: -2365
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 60
Instability Index: 9173.08 Extinction Coefficient cystines: 1490
Absorbance 280nm: 124.17

Literature

  • PubMed ID:  20298575
  • Title:  Neuropeptidomic Analysis of the Embryonic Japanese Quail Diencephalon